LDLRAD1 anticorps (Middle Region)
-
- Antigène Tous les produits LDLRAD1
- LDLRAD1 (Low Density Lipoprotein Receptor Class A Domain Containing 1 (LDLRAD1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LDLRAD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LDLRAD1 antibody was raised against the middle region of LDLRAD1
- Purification
- Affinity purified
- Immunogène
- LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LDLRAD1 Blocking Peptide, catalog no. 33R-1894, is also available for use as a blocking control in assays to test for specificity of this LDLRAD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDLRAD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." dans: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
: "
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." dans: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
-
- Antigène
- LDLRAD1 (Low Density Lipoprotein Receptor Class A Domain Containing 1 (LDLRAD1))
- Autre désignation
- LDLRAD1 (LDLRAD1 Produits)
- Synonymes
- anticorps OTTMUSG00000008594, anticorps low density lipoprotein receptor class A domain containing 1, anticorps LDLRAD1, anticorps Ldlrad1
- Sujet
- The function of LDLRAD1 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 22 kDa (MW of target protein)
-