ABCC8 anticorps

N° du produit ABIN635259

Détail du produit anti-ABCC8 anticorps

Antigène: ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCC8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCC8 Blocking Peptide, catalog no. 33R-7184, is also available for use as a blocking control in assays to test for specificity of this ABCC8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCC8

Antigène: ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))

Autre désignation: ABCC8 (ABCC8 Produits)

Synonymes: anticorps ABC36, anticorps HHF1, anticorps HI, anticorps HRINS, anticorps MRP8, anticorps PHHI, anticorps SUR, anticorps SUR1, anticorps SUR1delta2, anticorps TNDM2, anticorps D930031B21Rik, anticorps Sur, anticorps Sur1, anticorps ATP binding cassette subfamily C member 8, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 8, anticorps ABCC8, anticorps Abcc8

Sujet: ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.

Poids moléculaire: 177 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion