Dysferlin anticorps

N° du produit ABIN635272

Détail du produit anti-Dysferlin anticorps

Antigène: Dysferlin (DYSF)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Dysferlin est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids SRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DYSF Blocking Peptide, catalog no. 33R-8757, is also available for use as a blocking control in assays to test for specificity of this DYSF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYSF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Dysferlin

Antigène: Dysferlin (DYSF)

Autre désignation: DYSF (DYSF Produits)

Synonymes: anticorps DYSF, anticorps fb73b05, anticorps wu:fb73b05, anticorps si:rp71-50c18.1, anticorps DKFZp459E1226, anticorps 2310004N10Rik, anticorps AI604795, anticorps D6Pas3, anticorps mFLJ00175, anticorps FER1L1, anticorps LGMD2B, anticorps MMD1, anticorps dysferlin, anticorps dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive), anticorps myoferlin, anticorps DYSF, anticorps dysf, anticorps LOC589501, anticorps Dysf

Sujet: DYSF belongs to the ferlin family and is a skeletal muscle protein found associated with the sarcolemma. It is involved in muscle contraction and contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. In addition, DYSF binds caveolin-3, a skeletal muscle membrane protein which is important in the formation of caveolae. Specific mutations in this gene have been shown to cause autosomal recessive limb girdle muscular dystrophy type 2B (LGMD2B) as well as Miyoshi myopathy.

Poids moléculaire: 237 kDa (MW of target protein)