CCL17 anticorps

N° du produit ABIN635290

Détail du produit anti-CCL17 anticorps

Antigène: CCL17 (Chemokine (C-C Motif) Ligand 17 (CCL17))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCL17 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCD2 Blocking Peptide, catalog no. 33R-10001, is also available for use as a blocking control in assays to test for specificity of this ABCD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCL17

Antigène: CCL17 (Chemokine (C-C Motif) Ligand 17 (CCL17))

Autre désignation: ABCD2 (CCL17 Produits)

Synonymes: anticorps A-152E5.3, anticorps ABCD-2, anticorps SCYA17, anticorps TARC, anticorps CCL17, anticorps Abcd-2, anticorps Scya17, anticorps Scya17l, anticorps Tarc, anticorps abcd2, anticorps C-C motif chemokine ligand 17, anticorps chemokine (C-C motif) ligand 17, anticorps ATP-binding cassette sub-family D member 2, anticorps CCL17, anticorps Ccl17, anticorps LOC100537809

Sujet: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Poids moléculaire: 83 kDa (MW of target protein)