ATP1B1 anticorps (N-Term)
-
- Antigène Voir toutes ATP1B1 Anticorps
- ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP1B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP1 B1 antibody was raised against the N terminal of ATP1 1
- Purification
- Affinity purified
- Immunogène
- ATP1 B1 antibody was raised using the N terminal of ATP1 1 corresponding to a region with amino acids RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD
- Top Product
- Discover our top product ATP1B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP1B1 Blocking Peptide, catalog no. 33R-8238, is also available for use as a blocking control in assays to test for specificity of this ATP1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))
- Autre désignation
- ATP1B1 (ATP1B1 Produits)
- Synonymes
- anticorps ATP1B, anticorps Atp4b, anticorps Atpb, anticorps Atpb-1, anticorps NKbeta1, anticorps ATPBS, anticorps atp1b1, anticorps atp1b1a, anticorps cb710, anticorps ATPase Na+/K+ transporting subunit beta 1, anticorps ATPase, Na+/K+ transporting, beta 1 polypeptide, anticorps ATPase beta chain, anticorps ATP synthase CF1 beta subunit, anticorps ATPase Na+/K+ transporting subunit beta 1 S homeolog, anticorps ATPase, Na+/K+ transporting, beta 1b polypeptide, anticorps ATP1B1, anticorps Atp1b1, anticorps atpB, anticorps atp1b1.S, anticorps atp1b1b
- Sujet
- ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis, Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interactome
-