ATP1B1 anticorps (N-Term)

N° du produit ABIN635297

Détail du produit anti-ATP1B1 anticorps

Antigène: ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP1B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP1 B1 antibody was raised against the N terminal of ATP1 1

Purification: Affinity purified

Immunogène: ATP1 B1 antibody was raised using the N terminal of ATP1 1 corresponding to a region with amino acids RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP1B1 Blocking Peptide, catalog no. 33R-8238, is also available for use as a blocking control in assays to test for specificity of this ATP1B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP1B1

Antigène: ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))

Autre désignation: ATP1B1 (ATP1B1 Produits)

Synonymes: anticorps ATP1B, anticorps Atp4b, anticorps Atpb, anticorps Atpb-1, anticorps NKbeta1, anticorps ATPBS, anticorps atp1b1, anticorps atp1b1a, anticorps cb710, anticorps ATPase Na+/K+ transporting subunit beta 1, anticorps ATPase, Na+/K+ transporting, beta 1 polypeptide, anticorps ATPase beta chain, anticorps ATP synthase CF1 beta subunit, anticorps ATPase Na+/K+ transporting subunit beta 1 S homeolog, anticorps ATPase, Na+/K+ transporting, beta 1b polypeptide, anticorps ATP1B1, anticorps Atp1b1, anticorps atpB, anticorps atp1b1.S, anticorps atp1b1b

Sujet: ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interactome