CST9 anticorps

N° du produit ABIN635300

Détail du produit anti-CST9 anticorps

Antigène: CST9 (Cystatin 9 (Testatin) (CST9))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CST9 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Cystatin 9 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cystatin 9 Blocking Peptide, catalog no. 33R-3925, is also available for use as a blocking control in assays to test for specificity of this Cystatin 9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CST9

Antigène: CST9 (Cystatin 9 (Testatin) (CST9))

Autre désignation: Cystatin 9 (CST9 Produits)

Synonymes: anticorps M12, anticorps cresp, anticorps testatin, anticorps CLM, anticorps CTES7A, anticorps cystatin 9, anticorps cystatin-9, anticorps Cst9, anticorps CST9, anticorps LOC781567

Sujet: CST9 is part of the cystatin superfamily which encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions.

Poids moléculaire: 18 kDa (MW of target protein)