TMEM79 anticorps (C-Term)

N° du produit ABIN635317

Cet anticorps Lapin Polyclonal détecte spécifiquement TMEM79 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour TMEM79 anticorps (C-Term) (ABIN635317)

Antigène: TMEM79 (Transmembrane Protein 79 (TMEM79))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM79 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM79 anticorps

Épitope: C-Term

Specificité: TMEM79 antibody was raised against the C terminal of TMEM79

Purification: Affinity purified

Immunogène: TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM79 Blocking Peptide, (ABIN5616689), is also available for use as a blocking control in assays to test for specificity of this TMEM79 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM79 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM79

Antigène: TMEM79 (Transmembrane Protein 79 (TMEM79))

Autre désignation: TMEM79

Sujet: TMEM79 is a multi-pass membrane protein. The exact function of TMEM79 remains unknown.

Poids moléculaire: 43 kDa (MW of target protein)