TMEM79 anticorps (C-Term)
-
- Antigène Voir toutes TMEM79 Anticorps
- TMEM79 (Transmembrane Protein 79 (TMEM79))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM79 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM79 antibody was raised against the C terminal of TMEM79
- Purification
- Affinity purified
- Immunogène
- TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG
- Top Product
- Discover our top product TMEM79 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM79 Blocking Peptide, catalog no. 33R-5272, is also available for use as a blocking control in assays to test for specificity of this TMEM79 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM79 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM79 (Transmembrane Protein 79 (TMEM79))
- Autre désignation
- TMEM79 (TMEM79 Produits)
- Synonymes
- anticorps 2310042N02Rik, anticorps 2310074C17Rik, anticorps RGD1309886, anticorps transmembrane protein 79, anticorps TMEM79, anticorps Tmem79
- Sujet
- TMEM79 is a multi-pass membrane protein. The exact function of TMEM79 remains unknown.
- Poids moléculaire
- 43 kDa (MW of target protein)
-