ABCB1 anticorps

N° du produit ABIN635318

Détail du produit anti-ABCB1 anticorps

Antigène: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCB1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCB1 Blocking Peptide, catalog no. 33R-1285, is also available for use as a blocking control in assays to test for specificity of this ABCB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCB1

Antigène: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Autre désignation: ABCB1 (ABCB1 Produits)

Synonymes: anticorps ABC20, anticorps CD243, anticorps CLCS, anticorps GP170, anticorps MDR1, anticorps P-GP, anticorps PGY1, anticorps Abcb1, anticorps Mdr1a, anticorps p-gp, anticorps xemdr, anticorps Mdr1, anticorps Mdr1b, anticorps Pgy-1, anticorps Pgy1, anticorps mdr, anticorps ABCB1, anticorps PGP1, anticorps ATP binding cassette subfamily B member 1, anticorps ATP binding cassette subfamily B member 1A, anticorps ATP binding cassette subfamily B member 1 L homeolog, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 1B, anticorps ABCB1, anticorps Abcb1a, anticorps abcb1.L, anticorps Abcb1b, anticorps Abcb1

Sujet: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Poids moléculaire: 141 kDa (MW of target protein)