SLC27A3 anticorps

N° du produit ABIN635324

Détail du produit anti-SLC27A3 anticorps

Antigène: SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC27A3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC27 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC27A3 Blocking Peptide, catalog no. 33R-7087, is also available for use as a blocking control in assays to test for specificity of this SLC27A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC27A3

Antigène: SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))

Autre désignation: SLC27A3 (FATP3 Produits)

Synonymes: anticorps ACSVL3, anticorps FATP3, anticorps VLCS-3, anticorps Acsvl3, anticorps Vlcs-3, anticorps solute carrier family 27 member 3, anticorps solute carrier family 27 (fatty acid transporter), member 3, anticorps Slc27a3, anticorps SLC27A3

Sujet: SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.

Poids moléculaire: 79 kDa (MW of target protein)