SPATA9 anticorps (N-Term)
-
- Antigène Voir toutes SPATA9 Anticorps
- SPATA9 (Spermatogenesis Associated 9 (SPATA9))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPATA9 est non-conjugé
- Application
- Western Blotting (WB)
- Specificité
- SPATA9 antibody was raised against the N terminal of SPATA9
- Purification
- Affinity purified
- Immunogène
- SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR
- Top Product
- Discover our top product SPATA9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPATA9 Blocking Peptide, catalog no. 33R-2943, is also available for use as a blocking control in assays to test for specificity of this SPATA9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPATA9 (Spermatogenesis Associated 9 (SPATA9))
- Autre désignation
- SPATA9 (SPATA9 Produits)
- Synonymes
- anticorps SPATA9, anticorps NYD-SP16, anticorps 1700030K01Rik, anticorps 4930599C08Rik, anticorps A930023H06Rik, anticorps spermatogenesis associated 9, anticorps SPATA9, anticorps Spata9
- Sujet
- SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.
- Poids moléculaire
- 29 kDa (MW of target protein)
-