Slc30a3 anticorps

N° du produit ABIN635335

Détail du produit anti-Slc30a3 anticorps

Antigène: Slc30a3 (Solute Carrier Family 30 (Zinc Transporter), Member 3 (Slc30a3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Slc30a3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC30 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC30A3 Blocking Peptide, catalog no. 33R-1388, is also available for use as a blocking control in assays to test for specificity of this SLC30A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Slc30a3

Antigène: Slc30a3 (Solute Carrier Family 30 (Zinc Transporter), Member 3 (Slc30a3))

Autre désignation: SLC30A3 (Slc30a3 Produits)

Synonymes: anticorps pp12488, anticorps slc30a3, anticorps znt-2, anticorps znt2, anticorps ZnT3, anticorps ZNT3, anticorps Znt3, anticorps T32F6.21, anticorps T32F6_21, anticorps zinc transporter 3 precursor, anticorps solute carrier family 30 member 2, anticorps solute carrier family 30 member 3, anticorps solute carrier family 30 (zinc transporter), member 3, anticorps zinc transporter 3 precursor, anticorps slc30a2, anticorps SLC30A3, anticorps Slc30a3, anticorps ZIP3

Sujet: SLC30A3 is involved in accumulation of zinc in synaptic vesicles.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis