B3GAT3 anticorps
-
- Antigène Voir toutes B3GAT3 Anticorps
- B3GAT3 (beta-1,3-Glucuronyltransferase 3 (Glucuronosyltransferase I) (B3GAT3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp B3GAT3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- B3 GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY
- Top Product
- Discover our top product B3GAT3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
B3GAT3 Blocking Peptide, catalog no. 33R-7265, is also available for use as a blocking control in assays to test for specificity of this B3GAT3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 AT3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- B3GAT3 (beta-1,3-Glucuronyltransferase 3 (Glucuronosyltransferase I) (B3GAT3))
- Autre désignation
- B3GAT3 (B3GAT3 Produits)
- Synonymes
- anticorps GLCATI, anticorps 2810405M13Rik, anticorps GlcUAT-I, anticorps Glcat-i, anticorps beta-1,3-glucuronyltransferase 3, anticorps beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I), anticorps B3GAT3, anticorps B3gat3
- Sujet
- The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans.
- Poids moléculaire
- 37 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-