SLC7A2 anticorps
-
- Antigène Voir toutes SLC7A2 Anticorps
- SLC7A2 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 2 (SLC7A2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC7A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC7 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
- Top Product
- Discover our top product SLC7A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC7A2 Blocking Peptide, catalog no. 33R-9430, is also available for use as a blocking control in assays to test for specificity of this SLC7A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC7A2 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 2 (SLC7A2))
- Autre désignation
- SLC7A2 (SLC7A2 Produits)
- Synonymes
- anticorps slc7a2, anticorps CAT2, anticorps CAT-2, anticorps MGC83504, anticorps zgc:103686, anticorps ATRC2, anticorps HCAT2, anticorps AI158848, anticorps Atrc2, anticorps Cat2, anticorps Tea, anticorps Cat2a, anticorps Cat2b, anticorps RCAT2, anticorps cCAT-2, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 2 L homeolog, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, anticorps solute carrier family 7 member 2, anticorps slc7a2.2.L, anticorps slc7a2, anticorps SLC7A2, anticorps Slc7a2
- Sujet
- SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.
- Poids moléculaire
- 72 kDa (MW of target protein)
-