SLC37A4 anticorps
-
- Antigène Voir toutes SLC37A4 Anticorps
- SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC37A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC37 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLV
- Top Product
- Discover our top product SLC37A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC37A4 Blocking Peptide, catalog no. 33R-5506, is also available for use as a blocking control in assays to test for specificity of this SLC37A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))
- Autre désignation
- SLC37A4 (SLC37A4 Produits)
- Synonymes
- anticorps G6PT1, anticorps G6PT2, anticorps G6PT3, anticorps GSD1b, anticorps GSD1c, anticorps GSD1d, anticorps TRG-19, anticorps TRG19, anticorps G6PC, anticorps G6PT, anticorps G6pt1, anticorps GSD-1b, anticorps mG6PT, anticorps MGC68695, anticorps g6pt1, anticorps g6pt2, anticorps g6pt3, anticorps gsd1b, anticorps gsd1c, anticorps gsd1d, anticorps trg19, anticorps pro0685, anticorps MGC97640, anticorps slc37a4, anticorps wu:fc25d06, anticorps zgc:77098, anticorps solute carrier family 37 member 4, anticorps solute carrier family 37 (glucose-6-phosphate transporter), member 4, anticorps solute carrier family 37 member 4 L homeolog, anticorps solute carrier family 37 (glucose-6-phosphate transporter), member 4a, anticorps SLC37A4, anticorps Slc37a4, anticorps slc37a4.L, anticorps slc37a4, anticorps slc37a4a
- Sujet
- SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
- Poids moléculaire
- 46 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis, Cellular Glucan Metabolic Process
-