SLC6A1 anticorps

N° du produit ABIN635367

Détail du produit anti-SLC6A1 anticorps

Antigène: SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC6A1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC6 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC6A1 Blocking Peptide, catalog no. 33R-1650, is also available for use as a blocking control in assays to test for specificity of this SLC6A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC6A1

Antigène: SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))

Autre désignation: SLC6A1 (GAT1 Produits)

Synonymes: anticorps GABATHG, anticorps GABATR, anticorps GAT1, anticorps A730043E01, anticorps GAT-1, anticorps Gabt, anticorps Gabt1, anticorps Gat1, anticorps XT-1, anticorps Xtrp1, anticorps si:ch211-280e18.1, anticorps si:dkey-164m14.1, anticorps slc6a1, anticorps solute carrier family 6 member 1, anticorps solute carrier family 6 (neurotransmitter transporter, GABA), member 1, anticorps solute carrier family 6 (neurotransmitter transporter, GABA), member 1, like, anticorps GABA neurotransmitter transporter 1, anticorps SLC6A1, anticorps Slc6a1, anticorps slc6a1l, anticorps slc6a1

Sujet: SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.

Poids moléculaire: 67 kDa (MW of target protein)