SLC24A4 anticorps
-
- Antigène Voir toutes SLC24A4 (Slc24a4) Anticorps
- SLC24A4 (Slc24a4) (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 4 (Slc24a4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC24A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC24 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI
- Top Product
- Discover our top product Slc24a4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC24A4 Blocking Peptide, catalog no. 33R-7357, is also available for use as a blocking control in assays to test for specificity of this SLC24A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC24A4 (Slc24a4) (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 4 (Slc24a4))
- Autre désignation
- SLC24A4 (Slc24a4 Produits)
- Synonymes
- anticorps NCKX4, anticorps SHEP6, anticorps SLC24A2, anticorps A930002M03Rik, anticorps AW492432, anticorps Nckx4, anticorps solute carrier family 24 member 4, anticorps solute carrier family 24 (sodium/potassium/calcium exchanger), member 4, anticorps SLC24A4, anticorps Slc24a4
- Sujet
- Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions.
- Poids moléculaire
- 65 kDa (MW of target protein)
-