Podoplanin anticorps (Middle Region)
-
- Antigène Voir toutes Podoplanin (PDPN) Anticorps
- Podoplanin (PDPN)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Podoplanin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Podoplanin antibody was raised against the middle region of PDPN
- Purification
- Affinity purified
- Immunogène
- Podoplanin antibody was raised using the middle region of PDPN corresponding to a region with amino acids VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM
- Top Product
- Discover our top product PDPN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Podoplanin Blocking Peptide, catalog no. 33R-9441, is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Podoplanin (PDPN)
- Autre désignation
- Podoplanin (PDPN Produits)
- Synonymes
- anticorps PDPN, anticorps AGGRUS, anticorps GP36, anticorps GP40, anticorps Gp38, anticorps HT1A-1, anticorps OTS8, anticorps PA2.26, anticorps T1A, anticorps T1A-2, anticorps OTS-8, anticorps RANDAM-2, anticorps T1-alpha, anticorps T1a, anticorps T1alpha, anticorps E11, anticorps RTI40, anticorps podoplanin, anticorps PDPN, anticorps Pdpn
- Sujet
- PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-