DPP6 anticorps (Middle Region)
-
- Antigène Voir toutes DPP6 Anticorps
- DPP6 (Dipeptidyl-Peptidase 6 (DPP6))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DPP6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DPP6 antibody was raised against the middle region of DPP6
- Purification
- Affinity purified
- Immunogène
- DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT
- Top Product
- Discover our top product DPP6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DPP6 Blocking Peptide, catalog no. 33R-1028, is also available for use as a blocking control in assays to test for specificity of this DPP6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DPP6 (Dipeptidyl-Peptidase 6 (DPP6))
- Autre désignation
- DPP6 (DPP6 Produits)
- Synonymes
- anticorps dppx, anticorps DPPX, anticorps VF2, anticorps DPP VI, anticorps dpp6, anticorps si:ch211-198f16.1, anticorps B930011P16Rik, anticorps D5Buc3, anticorps D5Buc4, anticorps D5Buc5, anticorps Dpp-6, anticorps Gm1377, anticorps In(5)6H-p, anticorps Peplb, anticorps Rw, anticorps dipeptidyl peptidase like 6, anticorps dipeptidyl-peptidase 6, anticorps dipeptidyl-peptidase 6b, anticorps dipeptidylpeptidase 6, anticorps DPP6, anticorps dpp6, anticorps BCAN_A2221, anticorps BSUIS_A2016, anticorps Bsph_2289, anticorps BMEA_A2239, anticorps dpp6b, anticorps Dpp6
- Sujet
- DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.
- Poids moléculaire
- 91 kDa (MW of target protein)
-