PPP1R3A anticorps
-
- Antigène Voir toutes PPP1R3A Anticorps
- PPP1R3A (Protein Phosphatase 1, Regulatory Subunit 3A (PPP1R3A))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP1R3A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PPP1 R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE
- Top Product
- Discover our top product PPP1R3A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPP1R3A Blocking Peptide, catalog no. 33R-5946, is also available for use as a blocking control in assays to test for specificity of this PPP1R3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPP1R3A (Protein Phosphatase 1, Regulatory Subunit 3A (PPP1R3A))
- Autre désignation
- PPP1R3A (PPP1R3A Produits)
- Synonymes
- anticorps GM, anticorps RG1, anticorps RGL, anticorps PP1G, anticorps PPP1R3, anticorps PPP1R3A, anticorps protein phosphatase 1, regulatory (inhibitor) subunit 3A, anticorps protein phosphatase 1 regulatory subunit 3A, anticorps Ppp1r3a, anticorps PPP1R3A
- Sujet
- The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37 kDa catalytic subunit and a 124 kDa targeting and regulatory subunit.
- Poids moléculaire
- 126 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-