Ribophorin II anticorps (Middle Region)

N° du produit ABIN635418

Détail du produit anti-Ribophorin II anticorps

Antigène: Ribophorin II (RPN2)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ribophorin II est non-conjugé

Application: Western Blotting (WB)

Specificité: Ribophorin II antibody was raised against the middle region of RPN2

Purification: Affinity purified

Immunogène: Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ribophorin II Blocking Peptide, catalog no. 33R-4018, is also available for use as a blocking control in assays to test for specificity of this Ribophorin II antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ribophorin II

Antigène: Ribophorin II (RPN2)

Autre désignation: Ribophorin II (RPN2 Produits)

Synonymes: anticorps RIBIIR, anticorps RPN-II, anticorps RPNII, anticorps SWP1, anticorps RPN2, anticorps 1300012C06Rik, anticorps AV261018, anticorps Rpn-2, anticorps fb95d11, anticorps fj62b10, anticorps wu:fb61f08, anticorps wu:fb74e07, anticorps wu:fb95d11, anticorps wu:fj41f11, anticorps wu:fj62b10, anticorps rpn2, anticorps ribophorin II, anticorps dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2, anticorps ribophorin II S homeolog, anticorps RPN2, anticorps Rpn2, anticorps rpn2, anticorps LOC5579328, anticorps Bm1_30625, anticorps rpn2.S

Sujet: RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum.

Poids moléculaire: 67 kDa (MW of target protein)