LOC728864 (N-Term) anticorps
-
- Antigène
- LOC728864
- Épitope
- N-Term
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- LOC728864 antibody was raised against the N terminal Of Loc728864
- Purification
- Affinity purified
- Immunogène
- LOC728864 antibody was raised using the N terminal Of Loc728864 corresponding to a region with amino acids MAPLPTSHPSQAQDPHSWPCSPPHTPTKSRTHAHGPAPHLTPQPSPGPTL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LOC728864 Blocking Peptide, catalog no. 33R-5712, is also available for use as a blocking control in assays to test for specificity of this LOC728864 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC728864 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LOC728864
- Sujet
- The function of LOC728864 remains unkonwn.
- Poids moléculaire
- 22 kDa (MW of target protein)
-