SEMA4F anticorps (N-Term)
-
- Antigène Voir toutes SEMA4F Anticorps
- SEMA4F (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4F (SEMA4F))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SEMA4F est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SEMA4 F antibody was raised against N terminal of SEMA4
- Purification
- Affinity purified
- Immunogène
- SEMA4 F antibody was raised using the N terminal of SEMA4 corresponding to a region with amino acids PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
- Top Product
- Discover our top product SEMA4F Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SEMA4F Blocking Peptide, catalog no. 33R-7086, is also available for use as a blocking control in assays to test for specificity of this SEMA4F antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SEMA4F (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4F (SEMA4F))
- Autre désignation
- SEMA4F (SEMA4F Produits)
- Synonymes
- anticorps M-SEMA, anticorps PRO2353, anticorps S4F, anticorps SEMAM, anticorps SEMAW, anticorps m-Sema-M, anticorps ssemaphorin 4F, anticorps sema domain, immunoglobulin domain (Ig), TM domain, and short cytoplasmic domain, anticorps SEMA4F, anticorps Sema4f
- Sujet
- SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-