ATP2A3 anticorps (Middle Region)

N° du produit ABIN635430

Détail du produit anti-ATP2A3 anticorps

Antigène: ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP2A3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP2 A3 antibody was raised against the middle region of ATP2 3

Purification: Affinity purified

Immunogène: ATP2 A3 antibody was raised using the middle region of ATP2 3 corresponding to a region with amino acids LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP2A3 Blocking Peptide, catalog no. 33R-5064, is also available for use as a blocking control in assays to test for specificity of this ATP2A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP2A3

Antigène: ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))

Autre désignation: ATP2A3 (ATP2A3 Produits)

Synonymes: anticorps serca3, anticorps si:dkey-205l20.1, anticorps ATP2A3, anticorps Atp2a3, anticorps SERCA3, anticorps SERCA3b, anticorps Serca3, anticorps SERCA, anticorps ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 L homeolog, anticorps ATPase, Ca++ transporting, ubiquitous, anticorps ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3, anticorps atp2a3.L, anticorps atp2a3, anticorps ATP2A3, anticorps Atp2a3

Sujet: ATP2A3 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.

Poids moléculaire: 109 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Ribonucleoside Biosynthetic Process