ATP10D anticorps (C-Term)

N° du produit ABIN635469

Détail du produit anti-ATP10D anticorps

Antigène: ATP10D (ATPase, Class V, Type 10D (ATP10D))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP10D est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP10 D antibody was raised against the C terminal of ATP10

Purification: Affinity purified

Immunogène: ATP10 D antibody was raised using the C terminal of ATP10 corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP10D Blocking Peptide, catalog no. 33R-4952, is also available for use as a blocking control in assays to test for specificity of this ATP10D antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP10D

Antigène: ATP10D (ATPase, Class V, Type 10D (ATP10D))

Autre désignation: ATP10D (ATP10D Produits)

Synonymes: anticorps ATP10D, anticorps atp10d, anticorps MGC185750, anticorps ATPVD, anticorps 9830145H18Rik, anticorps D5Buc24e, anticorps ATPase phospholipid transporting 10D (putative), anticorps ATPase, class V, type 10D, anticorps ATP10D, anticorps atp10d, anticorps Atp10d

Sujet: ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily. The exact function of ATP10D remains unknown.

Poids moléculaire: 160 kDa (MW of target protein)