ORAI2 anticorps (Middle Region)

N° du produit ABIN635492

Détail du produit anti-ORAI2 anticorps

Antigène: ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ORAI2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ORAI2 antibody was raised against the middle region of ORAI2

Purification: Affinity purified

Immunogène: ORAI2 antibody was raised using the middle region of ORAI2 corresponding to a region with amino acids IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ORAI2 Blocking Peptide, catalog no. 33R-3944, is also available for use as a blocking control in assays to test for specificity of this ORAI2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORAI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ORAI2

Antigène: ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))

Autre désignation: ORAI2 (ORAI2 Produits)

Synonymes: anticorps C7orf19, anticorps CBCIP2, anticorps MEM142B, anticorps TMEM142B, anticorps A730041O15Rik, anticorps Tmem142b, anticorps RGD1310213, anticorps ORAI2, anticorps orai-1, anticorps orai1, anticorps tmem142a, anticorps tmem142b, anticorps LOC100230993, anticorps ORAI calcium release-activated calcium modulator 2, anticorps ORAI calcium release-activated calcium modulator 2 S homeolog, anticorps ORAI2, anticorps Orai2, anticorps orai2.S, anticorps orai2

Sujet: ORAI2 is a multi-pass membrane protein, and it belongs to the Orai family. It is a Ca(2+) release-activated Ca(2+)-like (CRAC-like) channel subunit which mediates Ca(2+) influx and increase in Ca(2+)-selective current by synergy with the Ca(2+) sensor, STIM1.

Poids moléculaire: 28 kDa (MW of target protein)