Junctophilin 2 anticorps (Middle Region)

N° du produit ABIN635496

Détail du produit anti-Junctophilin 2 anticorps

Antigène: Junctophilin 2 (JPH2)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Junctophilin 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Junctophilin 2 antibody was raised against the middle region of JPH2

Purification: Affinity purified

Immunogène: Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Junctophilin 2 Blocking Peptide, catalog no. 33R-1407, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Junctophilin 2

Antigène: Junctophilin 2 (JPH2)

Autre désignation: Junctophilin 2 (JPH2 Produits)

Synonymes: anticorps CMH17, anticorps JP-2, anticorps JP2, anticorps jp, anticorps 1110002E14Rik, anticorps Jp2, anticorps junctophilin 2, anticorps junctophilin-2, anticorps JPH2, anticorps LOC100461095, anticorps LOC610874, anticorps Jph2

Sujet: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH2 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.

Poids moléculaire: 74 kDa (MW of target protein)