INSIG2 anticorps (N-Term)

N° du produit ABIN635502

Cet anticorps anti-INSIG2 est un anticorps Polyclonal produit chez le Lapin, détectant INSIG2 dans WB. Convient pour Humain.

Aperçu rapide pour INSIG2 anticorps (N-Term) (ABIN635502)

Antigène: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp INSIG2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-INSIG2 anticorps

Épitope: N-Term

Specificité: INSIG2 antibody was raised against the N terminal of INSIG2

Purification: Affinity purified

Immunogène: INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

INSIG2 Blocking Peptide, (ABIN5614202), is also available for use as a blocking control in assays to test for specificity of this INSIG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur INSIG2

Antigène: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Autre désignation: INSIG2

Sujet: INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling