INSIG2 anticorps (N-Term)

N° du produit ABIN635502

Détail du produit anti-INSIG2 anticorps

Antigène: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp INSIG2 est non-conjugé

Application: Western Blotting (WB)

Specificité: INSIG2 antibody was raised against the N terminal of INSIG2

Purification: Affinity purified

Immunogène: INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

INSIG2 Blocking Peptide, catalog no. 33R-5639, is also available for use as a blocking control in assays to test for specificity of this INSIG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur INSIG2

Antigène: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Autre désignation: INSIG2 (INSIG2 Produits)

Synonymes: anticorps MGC82156, anticorps INSIG-2, anticorps 2900053I11Rik, anticorps C730043J18Rik, anticorps Insig-2, anticorps insulin induced gene 2, anticorps insulin induced gene 2 L homeolog, anticorps insig2, anticorps insig2.L, anticorps INSIG2, anticorps Insig2

Sujet: INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling