TMEM176A anticorps (Middle Region)

N° du produit ABIN635509

Détail du produit anti-TMEM176A anticorps

Antigène: TMEM176A (Transmembrane Protein 176A (TMEM176A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM176A est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM176 A antibody was raised against the middle region of TMEM176

Purification: Affinity purified

Immunogène: TMEM176 A antibody was raised using the middle region of TMEM176 corresponding to a region with amino acids GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM176A Blocking Peptide, catalog no. 33R-3687, is also available for use as a blocking control in assays to test for specificity of this TMEM176A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM170 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM176A

Antigène: TMEM176A (Transmembrane Protein 176A (TMEM176A))

Autre désignation: TMEM176A (TMEM176A Produits)

Synonymes: anticorps GS188, anticorps HCA112, anticorps 0610011I04Rik, anticorps AU040201, anticorps AU041743, anticorps Keg2, anticorps 0610011i04rik, anticorps RGD1310725, anticorps CL1, anticorps transmembrane protein 176A, anticorps TMEM176A, anticorps Tmem176a

Sujet: TMEM161A may be involved in the development of dendritic cells.

Poids moléculaire: 26 kDa (MW of target protein)