PIGW anticorps (Middle Region)

N° du produit ABIN635512

Détail du produit anti-PIGW anticorps

Antigène: PIGW (Phosphatidylinositol Glycan W (PIGW))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIGW est non-conjugé

Application: Western Blotting (WB)

Specificité: PIGW antibody was raised against the middle region of PIGW

Purification: Affinity purified

Immunogène: PIGW antibody was raised using the middle region of PIGW corresponding to a region with amino acids IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGW Blocking Peptide, catalog no. 33R-3893, is also available for use as a blocking control in assays to test for specificity of this PIGW antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGW antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIGW

Antigène: PIGW (Phosphatidylinositol Glycan W (PIGW))

Autre désignation: PIGW (PIGW Produits)

Synonymes: anticorps Gwt1, anticorps PIG-W, anticorps 2610044A17Rik, anticorps phosphatidylinositol glycan anchor biosynthesis class W, anticorps phosphatidylinositol glycan anchor biosynthesis, class W, anticorps PIGW, anticorps Pigw

Sujet: Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Inositol Metabolic Process