NTSR1 anticorps

N° du produit ABIN635539

Détail du produit anti-NTSR1 anticorps

Antigène: NTSR1 (Neurotensin Receptor 1 (High Affinity) (NTSR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NTSR1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NTSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NTSR1 Blocking Peptide, catalog no. 33R-2909, is also available for use as a blocking control in assays to test for specificity of this NTSR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTSR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NTSR1

Antigène: NTSR1 (Neurotensin Receptor 1 (High Affinity) (NTSR1))

Autre désignation: NTSR1 (NTSR1 Produits)

Synonymes: anticorps NTSR1, anticorps Ntsr, anticorps NT-1R, anticorps NTR-1, anticorps NTR1, anticorps NTR, anticorps neurotensin receptor 1, anticorps neurotensin receptor 1 (high affinity), anticorps NTSR1, anticorps Ntsr1

Sujet: Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia and antinociception.

Poids moléculaire: 46 kDa (MW of target protein)