NTSR1 anticorps
-
- Antigène Voir toutes NTSR1 Anticorps
- NTSR1 (Neurotensin Receptor 1 (High Affinity) (NTSR1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NTSR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NTSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT
- Top Product
- Discover our top product NTSR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NTSR1 Blocking Peptide, catalog no. 33R-2909, is also available for use as a blocking control in assays to test for specificity of this NTSR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTSR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NTSR1 (Neurotensin Receptor 1 (High Affinity) (NTSR1))
- Autre désignation
- NTSR1 (NTSR1 Produits)
- Synonymes
- anticorps NTSR1, anticorps Ntsr, anticorps NT-1R, anticorps NTR-1, anticorps NTR1, anticorps NTR, anticorps neurotensin receptor 1, anticorps neurotensin receptor 1 (high affinity), anticorps NTSR1, anticorps Ntsr1
- Sujet
- Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia and antinociception.
- Poids moléculaire
- 46 kDa (MW of target protein)
-