VTI1A anticorps

N° du produit ABIN635544

Détail du produit anti-VTI1A anticorps

Antigène: VTI1A (Vesicle Transport through Interaction with t-SNAREs 1A (VTI1A))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VTI1A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VTI1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VTI1A Blocking Peptide, catalog no. 33R-8790, is also available for use as a blocking control in assays to test for specificity of this VTI1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VTI0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VTI1A

Antigène: VTI1A (Vesicle Transport through Interaction with t-SNAREs 1A (VTI1A))

Autre désignation: VTI1A (VTI1A Produits)

Synonymes: anticorps zgc:109895, anticorps mvti1, anticorps vti1-rp2, anticorps DDBDRAFT_0219803, anticorps DDBDRAFT_0231536, anticorps DDB_0219803, anticorps DDB_0231536, anticorps MMDS3, anticorps MVti1, anticorps VTI1RP2, anticorps Vti1-rp2, anticorps 1110014F16Rik, anticorps 1110018K19Rik, anticorps 4921537J05Rik, anticorps MVti1a, anticorps Vti1, anticorps vesicle transport through interaction with t-SNAREs 1A L homeolog, anticorps vesicle transport through interaction with t-SNAREs 1A, anticorps v-SNARE family protein, anticorps vti1a.L, anticorps vti1a, anticorps VTI1A, anticorps vti1A, anticorps Vti1a

Sujet: VTI1A is a V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. VTI1A may be concerned with increased secretion of cytokines associated with cellular senescence.

Poids moléculaire: 25 kDa (MW of target protein)