POMT1 anticorps (Middle Region)

N° du produit ABIN635552

Détail du produit anti-POMT1 anticorps

Antigène: POMT1 (Protein-O-Mannosyltransferase 1 (POMT1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POMT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: POMT1 antibody was raised against the middle region of POMT1

Purification: Affinity purified

Immunogène: POMT1 antibody was raised using the middle region of POMT1 corresponding to a region with amino acids LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POMT1 Blocking Peptide, catalog no. 33R-5473, is also available for use as a blocking control in assays to test for specificity of this POMT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POMT1

Antigène: POMT1 (Protein-O-Mannosyltransferase 1 (POMT1))

Autre désignation: POMT1 (POMT1 Produits)

Synonymes: anticorps LGMD2K, anticorps MDDGA1, anticorps MDDGB1, anticorps MDDGC1, anticorps RT, anticorps AI505244, anticorps protein O-mannosyltransferase 1, anticorps protein-O-mannosyltransferase 1, anticorps POMT1, anticorps Pomt1

Sujet: POMT1 is an O-mannosyltransferase that requires interaction with the product of the POMT2 gene for enzymatic function. The encoded protein is found in the membrane of the endoplasmic reticulum. Defects in this gene are a cause of Walker-Warburg syndrome (WWS) and limb-girdle muscular dystrophy type 2K (LGMD2K).

Poids moléculaire: 82 kDa (MW of target protein)