ANO1 anticorps (Middle Region)

N° du produit ABIN635577

Détail du produit anti-ANO1 anticorps

Antigène: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANO1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM16 A antibody was raised against the middle region of TMEM16

Purification: Affinity purified

Immunogène: TMEM16 A antibody was raised using the middle region of TMEM16 corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM16A Blocking Peptide, catalog no. 33R-3735, is also available for use as a blocking control in assays to test for specificity of this TMEM16A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANO1

Antigène: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Autre désignation: TMEM16A (ANO1 Produits)

Synonymes: anticorps DOG1, anticorps ORAOV2, anticorps TAOS2, anticorps TMEM16A, anticorps Tmem16a, anticorps anoctamin 1, anticorps anoctamin 1, calcium activated chloride channel, anticorps Ano1, anticorps ANO1

Sujet: TMEM16A belongs to the anoctamin family. TMEM16A acts as a calcium-activated chloride channel. It is required for normal tracheal development.

Poids moléculaire: 111 kDa (MW of target protein)