ZDHHC24 anticorps (N-Term)

N° du produit ABIN635580

Détail du produit anti-ZDHHC24 anticorps

Antigène: ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZDHHC24 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZDHHC24 antibody was raised against the N terminal of ZDHHC24

Purification: Affinity purified

Immunogène: ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZDHHC24 Blocking Peptide, catalog no. 33R-10279, is also available for use as a blocking control in assays to test for specificity of this ZDHHC24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZDHHC24

Antigène: ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))

Autre désignation: ZDHHC24 (ZDHHC24 Produits)

Synonymes: anticorps zgc:91907, anticorps wu:fe02b01, anticorps 5730496N17Rik, anticorps Leng4, anticorps zinc finger, DHHC-type containing 24, anticorps zinc finger DHHC-type containing 24, anticorps zinc finger, DHHC domain containing 24, anticorps zdhhc24, anticorps ZDHHC24, anticorps Zdhhc24

Sujet: The function of ZDHHC24 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 30 kDa (MW of target protein)