Sphingomyelin Synthase 1 anticorps (Middle Region)

N° du produit ABIN635582

Détail du produit anti-Sphingomyelin Synthase 1 anticorps

Antigène: Sphingomyelin Synthase 1 (SGMS1)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sphingomyelin Synthase 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SGMS1 antibody was raised against the middle region of SGMS1

Purification: Affinity purified

Immunogène: SGMS1 antibody was raised using the middle region of SGMS1 corresponding to a region with amino acids SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SGMS1 Blocking Peptide, catalog no. 33R-8327, is also available for use as a blocking control in assays to test for specificity of this SGMS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sphingomyelin Synthase 1

Antigène: Sphingomyelin Synthase 1 (SGMS1)

Autre désignation: SGMS1 (SGMS1 Produits)

Synonymes: anticorps MGC81436, anticorps TMEM23, anticorps MOB, anticorps MOB1, anticorps SMS1, anticorps hmob33, anticorps 9530058O11Rik, anticorps AI841905, anticorps C80702, anticorps Mob, anticorps Sms1, anticorps Sor1, anticorps Tmem23, anticorps sphingomyelin synthase 1, anticorps sphingomyelin synthase 1 S homeolog, anticorps phosphatidylcholine:ceramide cholinephosphotransferase 1, anticorps SGMS1, anticorps sgms1.S, anticorps LOC100013212, anticorps Sgms1

Sujet: SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin