Sphingomyelin Synthase 1 anticorps (Middle Region)

N° du produit ABIN635582

L’anticorps anti-Sphingomyelin Synthase 1 Polyclonal Lapin est utilisé pour la détection de Sphingomyelin Synthase 1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour Sphingomyelin Synthase 1 anticorps (Middle Region) (ABIN635582)

Antigène: Sphingomyelin Synthase 1 (SGMS1)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sphingomyelin Synthase 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Sphingomyelin Synthase 1 anticorps

Épitope: Middle Region

Specificité: SGMS1 antibody was raised against the middle region of SGMS1

Purification: Affinity purified

Immunogène: SGMS1 antibody was raised using the middle region of SGMS1 corresponding to a region with amino acids SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SGMS1 Blocking Peptide, (ABIN5616119), is also available for use as a blocking control in assays to test for specificity of this SGMS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sphingomyelin Synthase 1

Antigène: Sphingomyelin Synthase 1 (SGMS1)

Autre désignation: SGMS1

Sujet: SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin