IQCF1 anticorps (Middle Region)

N° du produit ABIN635588

Détail du produit anti-IQCF1 anticorps

Antigène: IQCF1 (IQ Motif Containing F1 (IQCF1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IQCF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IQCF1 antibody was raised against the middle region of IQCF1

Purification: Affinity purified

Immunogène: IQCF1 antibody was raised using the middle region of IQCF1 corresponding to a region with amino acids ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IQCF1 Blocking Peptide, catalog no. 33R-1560, is also available for use as a blocking control in assays to test for specificity of this IQCF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IQCF1

Antigène: IQCF1 (IQ Motif Containing F1 (IQCF1))

Autre désignation: IQCF1 (IQCF1 Produits)

Synonymes: anticorps 1700055J15Rik, anticorps IQ motif containing F1, anticorps IQCF1, anticorps Iqcf1

Sujet: The exact function of IQCF1 is not known.

Poids moléculaire: 24 kDa (MW of target protein)