IQCF1 anticorps (Middle Region)
-
- Antigène Tous les produits IQCF1
- IQCF1 (IQ Motif Containing F1 (IQCF1))
-
Épitope
- Middle Region
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IQCF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IQCF1 antibody was raised against the middle region of IQCF1
- Purification
- Affinity purified
- Immunogène
- IQCF1 antibody was raised using the middle region of IQCF1 corresponding to a region with amino acids ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IQCF1 Blocking Peptide, catalog no. 33R-1560, is also available for use as a blocking control in assays to test for specificity of this IQCF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IQCF1 (IQ Motif Containing F1 (IQCF1))
- Autre désignation
- IQCF1 (IQCF1 Produits)
- Synonymes
- anticorps 1700055J15Rik, anticorps IQ motif containing F1, anticorps IQCF1, anticorps Iqcf1
- Sujet
- The exact function of IQCF1 is not known.
- Poids moléculaire
- 24 kDa (MW of target protein)
-