ZP1 anticorps

N° du produit ABIN635594

Détail du produit anti-ZP1 anticorps

Antigène: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ZP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZP1 Blocking Peptide, catalog no. 33R-7410, is also available for use as a blocking control in assays to test for specificity of this ZP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZP1

Antigène: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Autre désignation: ZP1 (ZP1 Produits)

Synonymes: anticorps zona pellucida glycoprotein 1 (sperm receptor), anticorps zona pellucida glycoprotein 1, anticorps ZP1, anticorps Zp1

Sujet: The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.

Poids moléculaire: 70 kDa (MW of target protein)