SLC10A1 anticorps
-
- Antigène Voir toutes SLC10A1 Anticorps
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC10A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC10 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY
- Top Product
- Discover our top product SLC10A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC10A1 Blocking Peptide, catalog no. 33R-9542, is also available for use as a blocking control in assays to test for specificity of this SLC10A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))
- Autre désignation
- SLC10A1 (SLC10A1 Produits)
- Synonymes
- anticorps Ntcp, anticorps NTCP, anticorps Ntcp1, anticorps SBACT, anticorps solute carrier family 10 (sodium/bile acid cotransporter family), member 1, anticorps solute carrier family 10 member 1, anticorps Slc10a1, anticorps SLC10A1
- Sujet
- Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids.
- Poids moléculaire
- 38 kDa (MW of target protein)
-