SYT9 anticorps (Middle Region)

N° du produit ABIN635624

Détail du produit anti-SYT9 anticorps

Antigène: SYT9 (Synaptotagmin IX (SYT9))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SYT9 est non-conjugé

Application: Western Blotting (WB)

Specificité: SYT9 antibody was raised against the middle region of SYT9

Purification: Affinity purified

Immunogène: SYT9 antibody was raised using the middle region of SYT9 corresponding to a region with amino acids PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SYT9 Blocking Peptide, catalog no. 33R-7008, is also available for use as a blocking control in assays to test for specificity of this SYT9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYT9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SYT9

Antigène: SYT9 (Synaptotagmin IX (SYT9))

Autre désignation: SYT9 (SYT9 Produits)

Synonymes: anticorps Sytv, anticorps zgc:91875, anticorps synaptotagmin IX, anticorps synaptotagmin 9, anticorps synaptotagmin IXb, anticorps Syt9, anticorps SYT9, anticorps syt9, anticorps syt9b

Sujet: SYT9 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.

Poids moléculaire: 56 kDa (MW of target protein)