SERPINB13 anticorps

N° du produit ABIN635641

Détail du produit anti-SERPINB13 anticorps

Antigène: SERPINB13 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 13 (SERPINB13))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERPINB13 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SERPINB13 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERPINB13 Blocking Peptide, catalog no. 33R-8019, is also available for use as a blocking control in assays to test for specificity of this SERPINB13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERPINB13

Antigène: SERPINB13 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 13 (SERPINB13))

Autre désignation: SERPINB13 (SERPINB13 Produits)

Synonymes: anticorps HSHUR7SEQ, anticorps HUR7, anticorps PI13, anticorps headpin, anticorps 5430417G24, anticorps HURPIN, anticorps SERPINB13, anticorps SERPINB5, anticorps serpin family B member 13, anticorps serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 13, anticorps serpin family B member 12, anticorps SERPINB13, anticorps Serpinb13, anticorps SERPINB12

Sujet: SERPINB13 may play a role in the proliferation or differentiation of keratinocytes.

Poids moléculaire: 44 kDa (MW of target protein)