LYSMD4 anticorps (N-Term)
-
- Antigène Voir toutes LYSMD4 Anticorps
- LYSMD4 (LysM, Putative Peptidoglycan-Binding, Domain Containing 4 (LYSMD4))
-
Épitope
- N-Term
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LYSMD4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LYSMD4 antibody was raised against the N terminal of LYSMD4
- Purification
- Affinity purified
- Immunogène
- LYSMD4 antibody was raised using the N terminal of LYSMD4 corresponding to a region with amino acids PRREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPD
- Top Product
- Discover our top product LYSMD4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LYSMD4 Blocking Peptide, catalog no. 33R-7337, is also available for use as a blocking control in assays to test for specificity of this LYSMD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYSMD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LYSMD4 (LysM, Putative Peptidoglycan-Binding, Domain Containing 4 (LYSMD4))
- Autre désignation
- LYSMD4 (LYSMD4 Produits)
- Synonymes
- anticorps MGC83644, anticorps DKFZp469O0929, anticorps 4930506D23Rik, anticorps si:cr925803.2, anticorps si:dkey-111m11.2, anticorps zgc:77861, anticorps LysM domain containing 4, anticorps LysM, putative peptidoglycan-binding, domain containing 4 L homeolog, anticorps LysM, putative peptidoglycan-binding, domain containing 4, anticorps LYSMD4, anticorps lysmd4.L, anticorps Lysmd4, anticorps lysmd4
- Sujet
- The specific function of LYSMD4 is not yet known.
- Poids moléculaire
- 32 kDa (MW of target protein)
-