P4HTM anticorps (Middle Region)

N° du produit ABIN635661

Détail du produit anti-P4HTM anticorps

Antigène: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P4HTM est non-conjugé

Application: Western Blotting (WB)

Specificité: PH4 antibody was raised against the middle region of PH-4

Purification: Affinity purified

Immunogène: PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PH4 Blocking Peptide, catalog no. 33R-8025, is also available for use as a blocking control in assays to test for specificity of this PH4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PH-4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P4HTM

Antigène: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Autre désignation: PH4 (P4HTM Produits)

Synonymes: anticorps Ph-4, anticorps RGD1311848, anticorps EGLN4, anticorps HIFPH4, anticorps P4H-TM, anticorps PH-4, anticorps PH4, anticorps PHD4, anticorps 4933406E20Rik, anticorps AI853847, anticorps BB128974, anticorps prolyl 4-hydroxylase, transmembrane, anticorps prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum), anticorps shisa family member 5, anticorps P4htm, anticorps P4HTM, anticorps SHISA5

Sujet: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.

Poids moléculaire: 57 kDa (MW of target protein)