CHST8 anticorps
-
- Antigène Voir toutes CHST8 Anticorps
- CHST8 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 8 (CHST8))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHST8 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CHST8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST
- Top Product
- Discover our top product CHST8 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHST8 Blocking Peptide, catalog no. 33R-3192, is also available for use as a blocking control in assays to test for specificity of this CHST8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHST8 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 8 (CHST8))
- Autre désignation
- CHST8 (CHST8 Produits)
- Synonymes
- anticorps MGC146666, anticorps GALNAC4ST1, anticorps GalNAc4ST, anticorps 1500011J21Rik, anticorps AI426009, anticorps carbohydrate sulfotransferase 8, anticorps carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8, anticorps CHST8, anticorps chst8, anticorps Chst8
- Sujet
- Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates.
- Poids moléculaire
- 49 kDa (MW of target protein)
-