SEMA6D anticorps (N-Term)
-
- Antigène Voir toutes SEMA6D Anticorps
- SEMA6D (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6D (SEMA6D))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SEMA6D est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SEMA6 D antibody was raised against the N terminal of SEMA6
- Purification
- Affinity purified
- Immunogène
- SEMA6 D antibody was raised using the N terminal of SEMA6 corresponding to a region with amino acids KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN
- Top Product
- Discover our top product SEMA6D Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SEMA6D Blocking Peptide, catalog no. 33R-4550, is also available for use as a blocking control in assays to test for specificity of this SEMA6D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SEMA6D (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6D (SEMA6D))
- Autre désignation
- SEMA6D (SEMA6D Produits)
- Synonymes
- anticorps 1110067B02Rik, anticorps AA409156, anticorps D330011G23, anticorps Sema6D-1, anticorps Sema6D-2, anticorps Sema6D-4, anticorps Sema6D-5, anticorps Sema6D-6, anticorps mKIAA1479, anticorps wu:fi06a12, anticorps wu:fi76a10, anticorps zgc:56170, anticorps semaphorin 6D, anticorps sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D, anticorps semaphorin 6D L homeolog, anticorps SEMA6D, anticorps Sema6d, anticorps sema6d, anticorps sema6d.L
- Sujet
- Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.
- Poids moléculaire
- 65 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration
-