SEMA6A anticorps (Middle Region)
-
- Antigène Voir toutes SEMA6A Anticorps
- SEMA6A (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6A (SEMA6A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SEMA6A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SEMA6 A antibody was raised against the middle region of SEMA6
- Purification
- Affinity purified
- Immunogène
- SEMA6 A antibody was raised using the middle region of SEMA6 corresponding to a region with amino acids ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR
- Top Product
- Discover our top product SEMA6A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SEMA6A Blocking Peptide, catalog no. 33R-2716, is also available for use as a blocking control in assays to test for specificity of this SEMA6A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SEMA6A (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6A (SEMA6A))
- Autre désignation
- SEMA6A (SEMA6A Produits)
- Synonymes
- anticorps fj46c12, anticorps wu:fj46c12, anticorps zgc:66106, anticorps SEMA6A, anticorps HT018, anticorps SEMA, anticorps SEMA6A1, anticorps SEMAQ, anticorps VIA, anticorps 9330158E07, anticorps A730020P05Rik, anticorps AI851735, anticorps Sema6A-1, anticorps Semaq, anticorps VIa, anticorps b2b997Clo, anticorps sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A, anticorps semaphorin 6A, anticorps sema6a, anticorps SEMA6A, anticorps Sema6a
- Sujet
- SEMA6A can act as repulsive axon guidance cues. SEMA6A may play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation.
- Poids moléculaire
- 114 kDa (MW of target protein)
-