PTPRH anticorps (Middle Region)

N° du produit ABIN635715

Détail du produit anti-PTPRH anticorps

Antigène: PTPRH (Protein tyrosine Phosphatase, Receptor Type, H (PTPRH))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTPRH est non-conjugé

Application: Western Blotting (WB)

Specificité: PTPRH antibody was raised against the middle region of PTPRH

Purification: Affinity purified

Immunogène: PTPRH antibody was raised using the middle region of PTPRH corresponding to a region with amino acids QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTPRH Blocking Peptide, catalog no. 33R-7755, is also available for use as a blocking control in assays to test for specificity of this PTPRH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTPRH

Antigène: PTPRH (Protein tyrosine Phosphatase, Receptor Type, H (PTPRH))

Autre désignation: PTPRH (PTPRH Produits)

Synonymes: anticorps SAP-1, anticorps si:dkey-197c15.5, anticorps SAP1, anticorps sap-1, anticorps Bem2, anticorps protein tyrosine phosphatase, receptor type, h, anticorps protein tyrosine phosphatase, receptor type H, anticorps protein tyrosine phosphatase, receptor type, H, anticorps ptprh, anticorps PTPRH, anticorps Ptprh

Sujet: PTPRH is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. The extracellular region contains eight fibronectin type III-like repeats and multiple N-glycosylation sites. It was also found to be expressed in several cancer cell lines, but not in the corresponding normal tissues.

Poids moléculaire: 120 kDa (MW of target protein)