COMT anticorps (Middle Region)

N° du produit ABIN635716

Cet anticorps Lapin Polyclonal détecte spécifiquement COMT dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour COMT anticorps (Middle Region) (ABIN635716)

Antigène: COMT (Catechol-O-Methyltransferase (COMT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COMT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-COMT anticorps

Épitope: Middle Region

Specificité: COMT antibody was raised against the middle region of COMT

Purification: Affinity purified

Immunogène: COMT antibody was raised using the middle region of COMT corresponding to a region with amino acids PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COMT Blocking Peptide, (ABIN5612959), is also available for use as a blocking control in assays to test for specificity of this COMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COMT

Antigène: COMT (Catechol-O-Methyltransferase (COMT))

Autre désignation: COMT

Sujet: Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, SARS-CoV-2 Protein Interactome