COMT anticorps (Middle Region)

N° du produit ABIN635716

Détail du produit anti-COMT anticorps

Antigène: COMT (Catechol-O-Methyltransferase (COMT))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COMT est non-conjugé

Application: Western Blotting (WB)

Specificité: COMT antibody was raised against the middle region of COMT

Purification: Affinity purified

Immunogène: COMT antibody was raised using the middle region of COMT corresponding to a region with amino acids PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COMT Blocking Peptide, catalog no. 33R-7005, is also available for use as a blocking control in assays to test for specificity of this COMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COMT

Antigène: COMT (Catechol-O-Methyltransferase (COMT))

Autre désignation: COMT (COMT Produits)

Synonymes: anticorps Comt1, anticorps D16Wsu103e, anticorps D330014B15Rik, anticorps COMT, anticorps mb-comt, anticorps s-comt, anticorps comt, anticorps MGC154444, anticorps zgc:114157, anticorps si:dkey-13a21.15, anticorps zK13A21.15, anticorps zgc:162236, anticorps catechol-O-methyltransferase, anticorps microRNA 4761, anticorps catechol-O-methyltransferase S homeolog, anticorps methyltransferase, anticorps catechol-o-methyltransferase, anticorps catechol-O-methyltransferase a, anticorps catechol-O-methyltransferase b, anticorps catechol O-methyltransferase, anticorps COMT, anticorps Comt, anticorps MIR4761, anticorps comt, anticorps comt.2, anticorps comt.S, anticorps Rv1703c, anticorps Mb1729c, anticorps comta, anticorps comtb, anticorps LOC100354142

Sujet: Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, SARS-CoV-2 Protein Interactome