PSMA anticorps

N° du produit ABIN635723

Détail du produit anti-PSMA anticorps

Antigène: PSMA (FOLH1) (Folate Hydrolase (Prostate-Specific Membrane Antigen) 1 (FOLH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FOLH1 Blocking Peptide, catalog no. 33R-3141, is also available for use as a blocking control in assays to test for specificity of this FOLH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOLH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMA

Antigène: PSMA (FOLH1) (Folate Hydrolase (Prostate-Specific Membrane Antigen) 1 (FOLH1))

Autre désignation: FOLH1 (FOLH1 Produits)

Synonymes: anticorps FGCP, anticorps FOLH, anticorps GCP2, anticorps GCPII, anticorps NAALAD1, anticorps NAALAdase, anticorps PSM, anticorps PSMA, anticorps mGCP, anticorps mopsm, anticorps Naalad, anticorps putative N-acetylated-alpha-linked acidic dipeptidase, anticorps folate hydrolase 1B, anticorps folate hydrolase 1, anticorps folate hydrolase (prostate-specific membrane antigen) 1, anticorps LOC451185, anticorps FOLH1B, anticorps FOLH1, anticorps Folh1

Sujet: FOLH1 is a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity.

Poids moléculaire: 84 kDa (MW of target protein)